PLAY PODCASTS
434: From Vegetarian To Butcher
Episode 434

434: From Vegetarian To Butcher

What could possibly persuade someone to go from vegetarian to butcher? Kate Kavanaugh tells what shifted in her that led to this profound lifestyle and dietary change. Kate is indeed a butcher, and also a farmer, and the host of the Mind, Body, and...

Wise Traditions · Hilda Labrada Gore

August 21, 202341m 42s

Audio is streamed directly from the publisher (traffic.libsyn.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

What could possibly persuade someone to go from vegetarian to butcher? Kate Kavanaugh tells what shifted in her that led to this profound lifestyle and dietary change. Kate is indeed a butcher, and also a farmer, and the host of the Mind, Body, and Soil podcast, among other initiatives.

Today, she shares insights on our place in the complex web of nourishment. Among other things, she conveys her realization that what we eat becomes us, in a very real sense; how the seasons affect the fat and protein on an animal’s body; and how uncomfortable we feel with the death of animals…and just plain death, period. Kate also gets practical as she explains the process of processing (what happens to our meat before it hits our table) and how to find farms near us, wherever we live.

Visit Kate's websites: groundworkcollective.com and

westerndaughters.com

and her podcast  Mind, Body, and Soil

Make the 50% pledge - resources on our website: westonaprice.org

Check out our sponsors: Paleo Valley and Optimal Carnivore

 

Topics

relationshipfarmingvegetarianlifestyledietsustainabilitybutcherycollagen