PLAY PODCASTS
#589: The Hidden Epidemic Part 2: The Complete Endocrine Detox Strategy
Episode 589

#589: The Hidden Epidemic Part 2: The Complete Endocrine Detox Strategy

Vitality Radio Podcast with Jared St. Clair

November 22, 202555m 28s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

On this episode of Vitality Radio, Jared continues his deep dive into one of the most overlooked health threats of our time: endocrine-disrupting chemicals. If you haven’t listened to Part 1 yet, hit pause and go back — the two episodes build on each other, and the full picture will make far more sense when heard in order.


Here, we shift from identifying the problem to showing you how to clear it from your system naturally. This episode breaks down the detoxification phase of the long-awaited Endocrine Detox Protocol — built around four targeted formulas designed to support receptor clearance, liver pathways, gut integrity, and calcium balance to support healthy hormone signaling.


If you’ve been struggling with stubborn symptoms, slow progress, or hormone fluctuations despite “doing everything right,” this episode will help you understand what’s been missing — and how to finally address the upstream causes that matter.


Products:

LiverVitality

EndoCleanse

Back On Tract

Vital D3/K2 High Potency

Vital D3/K2

Magnesium Bisglycinate


Additional Information:

#588: The Hidden Epidemic Part 1: How Endocrine Disruptors Are Hijacking Your Health
#507: Comprehensive Digestive Support to Get Your Gut ‘Back On Tract’!

#565: D3, K2, Boron, and Silica: The Ultimate Synergy for Bones, Hormones, Arteries, and More!

#258: Your Magnesium User's Guide


Visit the podcast website here: VitalityRadio.com


You can follow @vitalitynutritionbountiful and @vitalityradio on Instagram, or Vitality Radio and Vitality Nutrition on Facebook. Join us also in the Vitality Radio Podcast Listener Community on Facebook. Shop the products that Jared mentions at vitalitynutrition.com. Let us know your thoughts about this episode using the hashtag #vitalityradio and please rate and review us on Apple Podcasts. Thank you!


Just a reminder that this podcast is for educational purposes only. The FDA has not evaluated the podcast. The information is not intended to diagnose, treat, cure, or prevent any disease. The advice given is not intended to replace the advice of your medical professional.

Topics

endocrine disruptorsEDCshormone balancethyroid healthmetabolismdetoxificationliver supportendocrine detoxneurotransmittersserotonindopaminecortisolestrogen dominancelow testosteronefertilitybrain foganxietysleepcalcificationpineal glandendocrine protocolLiver VitalityEndoCleanseBack on TractVital D3 K2environmental toxinsxenoestrogensHPA axisendocrinedetoxhormonesestrogentestosteroneDIMI3Clivergutmicrobiomefluoridetoxinsprobioticsbileglutathioneendocrine-systemmitochondriareceptor-clearanceK2D3silicaboronnatural-healthvitalitywellnessinflammationestrogen-metabolismliver-supportgut-health