PLAY PODCASTS
675 Look Good Naked with Mark Sisson
Season 1 · Episode 674

675 Look Good Naked with Mark Sisson

“IF YOU'RE NOT HUNGRY, DON'T EAT." Health is one of the most important things to me. If your body isn’t operating at 100% efficiency then your mind can’t either. A lot of this really does come down to diet. On a good diet, you will burn fat efficiently. You’ll have a healthier heart, your brain will function properly, and your body will be able to repair itself properly. This last part is huge for those who are recovering from surgery, or dealing with various diseases. Plus, there’s an added benefit on top of it all - you will lose weight and look great naked. Who doesn’t want that? To talk about the importance of a solid diet and how it can make a huge impact on your life overall, I brought back this clip from Mark Sisson. Mark talks about the importance of diet, all of the problems he’s seen it solve, and some myths that even professionals have about diet, specifically with protein shakes. Learn all about how you can look good naked, on Episode 675. In This Episode You Will Learn: Where Look Good Naked came from (00:37) Why people really want to LGN (00:57) What a typical day looks like for Mark (1:46) If you should really have a protein shake (2:48) The difference between a sugar burner and fat burner (3:12)

The School of Greatness

August 3, 20185m 3s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

“IF YOU'RE NOT HUNGRY, DON'T EAT."
Health is one of the most important things to me. If your body isn’t operating at 100% efficiency then your mind can’t either.
A lot of this really does come down to diet. On a good diet, you will burn fat efficiently. You’ll have a healthier heart, your brain will function properly, and your body will be able to repair itself properly.
This last part is huge for those who are recovering from surgery, or dealing with various diseases.
Plus, there’s an added benefit on top of it all - you will lose weight and look great naked.
Who doesn’t want that?
To talk about the importance of a solid diet and how it can make a huge impact on your life overall, I brought back this clip from Mark Sisson.
Mark talks about the importance of diet, all of the problems he’s seen it solve, and some myths that even professionals have about diet, specifically with protein shakes.
Learn all about how you can look good naked, on Episode 675.
In This Episode You Will Learn:
Where Look Good Naked came from (00:37)
Why people really want to LGN (00:57)
What a typical day looks like for Mark (1:46)
If you should really have a protein shake (2:48)
The difference between a sugar burner and fat burner (3:12)

Get more from Lewis! 

Get my New York Times Bestselling book, Make Money Easy!

Get The Greatness Mindset audiobook on Spotify

Text Lewis AI

YouTube

Instagram

Website

Tiktok

Facebook

X


Hosted by Simplecast, an AdsWizz company. See pcm.adswizz.com for information about our collection and use of personal data for advertising.

Topics

body repairhealthysugar burnerfat burnermark sissonnaked5 minute fridayrecoverylook goodlose weightdietefficiencyfitnessimpact