PLAY PODCASTS
#187: How Raw Dairy Is GREAT For Gut Health featuring Michelle Allen
Episode 187

#187: How Raw Dairy Is GREAT For Gut Health featuring Michelle Allen

The Meat Mafia Podcast

May 23, 202358m 6s

Audio is streamed directly from the publisher (2.gum.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

When Michelle Allen joined us on the podcast, we were excited to dive into her perspective on launching her company Mother Culture. The origins of the company are rooted in her own family's struggles in curing some severe allergies and illness. From the start of the conversation, we knew Michelle was going to bring a wealth of knowledge. She taught us all about:

- Why Raw Milk is healthy?
- How to cure allergies?
- Why food is medicine?
- How to heal the gut with food?
- How to start cooking nourishing meals for kids?
- How to take risks in business?
- What is the Weston A Price Foundation?
- What is the GAPS Diet and why is the GAPS Diet so good for gut health?

We spent a lot of time discussing the risks she took in starting her business. As a mother of 7, she went all in on her business and spent nearly every penny she had on her first piece of equipment (the one she still uses today). Whether you are looking to learn more about entrepreneurship or the power of healthy foods, you will absolutely enjoy this episode!

Connect with Meat Mafia:

Instagram - Meat Mafia
Twitter - Meat Mafia
YouTube - Meat Mafia

Connect with Noble Protein:

Website - Noble Protein
Twitter - Noble Protein
Instagram - Noble Protein

SPONSORS

  1. The Carnivore Bar - 10% OFF - Delicious & convenient Pemmican Bar
  2. Fond Bone Broth - 15% OFF - REAL bone broth with HIGH-QUALITY ingredients! It’s a daily product for us!
  3. Perennial Pastures - 10% OFF - Regeneratively raised, grass-fed & grass-finished beef from California & Montana
  4. NOBLE ORIGINS - Complete and simple, animal-based protein powder with an organ blend for additional nutrition!

AFFILIATES

  1. LMNT - Electrolyte salts to supplement minerals on low-carb diet
  2. Farrow Skincare - Use the CODE 'MAFIA' at checkout for 20% OFF 
  3. Heart & Soil - CODE ‘MEATMAFIA10’ for 10% OFF - enhanced nutrition to replace daily vitamins! 
  4. Carnivore Crisps - 10% OFF - Carnivore / Animal-based snacks for eating healthy on the go! CODE: MEATMAFIA
  5. Pluck Seasoning - 10% OFF - Nutrient-dense seasoning with INSANE flavor! CODE: MAFIA
  6. We Feed Raw - 25% OFF your first order - ancestrally consistent food for your dog! CODE 'MEATMAFIA25'

TIME STAMPS
2:30- The journey (background)
12:30- Food is medicine
14:00- Gut health
17:50- Processed is always worse quality
23:50- Start somewhere
27:30- Mother Culture
36:10- How long before being in retail stores
41:10- Figuring out a suitable farm to work with
45:50- Read your labels to know your product
50:30- Preparation matters

Topics

raw dairyraw milkyogurtmother cultureentrepreneurshipmilkdairyallergieshealthfitnessfat loss