PLAY PODCASTS
Make Failure IMPOSSIBLE By Becoming QUITPROOF with Extreme Endurance Athlete Tom Jones
Episode 475

Make Failure IMPOSSIBLE By Becoming QUITPROOF with Extreme Endurance Athlete Tom Jones

The Mark Divine Show · Mark Divine

July 30, 20241h 45m

Audio is streamed directly from the publisher (pscrb.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Becoming Quitproof is about pushing beyond perceived limits and transforming adversity into opportunity. Tom Jones's life of overcoming a rough childhood to becoming an extreme athlete and personal development coach—showcases the power of mental resilience and purposeful living. 

Tom Jones is an extreme athlete, Marine veteran, and personal development coach known for incredible feats like running from California to New York at marathon pace for 121 days and paddleboarding 1,250 miles from Oregon to Mexico. A seven-time Muay Thai Champion, he authored "Becoming Quit Proof" after overcoming a traumatic childhood. Jones embraces a holistic approach to life and uses extreme challenges to raise awareness for various causes, inspiring others to push their limits.

 

Key Takeaways 

 

  • Mental Toughness and Resilience: Develop a "quit-proof" mindset to overcome challenges and persevere through difficult situations. Cultivate resilience by maintaining a strong sense of purpose and viewing obstacles as opportunities for growth.

  • Holistic Personal Development: Embrace a comprehensive approach to personal growth by focusing on the "Five Mountains" of life - physical, mental, emotional, intuitive, and spiritual aspects of yourself. Recognize that true effectiveness and leadership stem from developing all these areas in harmony.

  • Mindfulness and Self-Awareness: Incorporate mindfulness techniques such as box breathing and meditation into your daily routine. These practices enhance self-awareness, improve decision-making, manage stress, and provide mental clarity in high-pressure situations.

  • Spiritual and Philosophical Growth: Explore deeper spiritual and philosophical concepts to broaden your perspective on life, consciousness, and reality. Understanding ideas like karma, dharma, and the nature of self can provide valuable insights for personal and professional development.

 

Sponsors and Promotions

 

Defender 

Ready for adventure? With a family of vehicles to choose from, you'll have the space, technology, and performance to go further than ever before. Explore the Defender lineup at https://www.LandRoverUSA.com/Defender   

 

Magic Spoon

Dive into a delicious bowl of Magic Spoon's new high-protein Treats, now available at your nearest grocery store.

 

Momentus:

Designed by the world's best experts, used by the world's best teams and athletes, and made for all of us.

https://www.livemomentous.com, and use code DIVINE for 20% off your first order.

 

MUD/WTR: 

Get up to 43% off your entire order, Free Shipping and a Free Rechargeable Frother when you use our exclusive link: mudwtr.com/DIVINE and grab your starter kit! After you purchase tell them you came from the podcast! Start your new morning ritual today.

 

SealFit ElectroGreens:

Fuel your body and conquer your limits with SealFit ElectroGreens - a USDA organic superfood packed with over 25 organic fruits, vegetables, and electrolytes. Head to Amazon, search for "SealFit ElectroGreens," and use code SEALGREENS25 at checkout for 25% off your order. 

 

Links for Tom Jones

Website

Instagram

Facebook

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

unbeatablemindyogakokoroyogasealfithealthpoliticsentrepreneurnavysealsfitnessmilitaryleadershipbusiness