PLAY PODCASTS
Gabrielle Lyon: A Muscle-Centric Approach to Longevity
Episode 340

Gabrielle Lyon: A Muscle-Centric Approach to Longevity

The Mark Divine Show · Mark Divine

December 28, 20211h 2m

Audio is streamed directly from the publisher (pscrb.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Today, Mark Divine speaks with Dr. Gabrielle Lyon about her muscle-centric approach to medicine, why obesity is a secondary problem, and how resistance training, high quality protein, and sleep are crucial to health and longevity.  

Key Takeaways:   Dr. Lyon's muscle-centric medicine focuses on the root cause of obesity, loss or defect of skeletal-muscle-skeletal-muscle is not only important for the well-known reasons of strength and increased metabolism. It is an endocrine organ. Every time skeletal-muscle contracts it excretes myokines. Myokines affect immunity, brain health, and the way we use nutrients.   

There are two ways to drive skeletal muscle, resistance training, and dietary protein. Resistance training looks different for everyone, but it is important to train to the point of muscle failure. Protein should be high quality, animal protein. 

Worldwide, over 100 million people suffer from sleep apnea.  Some of the risk factors for sleep apnea are: environmental exposure, inability to lose weight, anxiety, hypertension, and TBIs. Untreated sleep apnea is incredibly dangerous, as it is linked to hypertension, poor cardiovascular health, hormonal imbalances, anxiety, and depression. The good news is that it is easy to diagnose with an at-home sleep test. 

Testosterone naturally declines as we age. Training, diet, sleep, and reducing stress can all increase our testosterone levels, but it may not be enough to reach optimal levels without supplementation.. Optimal levels of testosterone affect quality of life in several ways including mood, energy, sex drive, and ability to maintain muscle. 

Links: Dr. Gabrielle Lyon Twitter Instagram YouTube

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

healthpoliticsfitnesskokoroyogabusinessyoganavysealsmilitarysealfitentrepreneurunbeatablemindleadership