PLAY PODCASTS
Don't Get Left Behind: How To Create Your Future with Frederik G. Pferdt Google's former Chief Innovation Evangelist
Episode 480

Don't Get Left Behind: How To Create Your Future with Frederik G. Pferdt Google's former Chief Innovation Evangelist

The Mark Divine Show · Mark Divine

September 3, 20241h 5m

Audio is streamed directly from the publisher (pscrb.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Ready to transform your life in 30 days? Join the Unbeatable Challenge now at unbeatablemind.com/30 and unlock your peak performance with Navy SEAL-proven techniques. Limited-time discount available – don't miss out!

 

If you don't actively shape your future, it will be shaped for you. This is the core message Dr. Frederik G. Pferdt wants you to understand. To take control of your future, start by developing a "future ready" mindset. Cultivate optimism, openness, curiosity, a willingness to experiment, and empathy. Dr. Pferdt introduces an important concept: your "mind state." Unlike fixed mindsets, your mind state is your perception in each moment, and it's something you can change and control. By working on your mind state, you can alter how you experience and interact with the world around you. Shaping your future is also about your environment. Dr. Pferdt emphasizes the importance of intentionally designing your physical spaces to support your aspirations. Your surroundings significantly influence your thoughts, feelings, and behaviors; Make sure they align with the future you're trying to create.

 

Dr. Frederik G. Pferdt, a pioneer in innovation and creativity, served as Google's inaugural Chief Innovation Evangelist and taught at Stanford University for over a decade. His visionary approach to living "future-ready" has been adopted by diverse organizations from the UN to NASA. With his work featured in over 250 media outlets worldwide, Dr. Pferdt's insights on shaping a better tomorrow are set to reach an even broader audience through his upcoming book, "What's Next Is Now – How to Live Future Ready."

 

Takeaways 

  • Future Readiness Mindset: The most impactful way to shape your future is to focus on who you want to become, rather than external factors or material goals. This involves cultivating a mindset of optimism, openness, curiosity, experimentation, and empathy.

  • The Power of Visualization and Future Self: Regularly visualizing and connecting with your desired future self can have a profound impact on achieving your goals. This practice helps align your current actions with your future aspirations.

  • Emotions in Innovation: Innovation is deeply tied to emotions. Understanding and effectively managing the emotional roller coaster of excitement, disappointment, frustration, and humility is crucial for successful innovation and creativity.

  • Situated Cognition and Environmental Design: Your physical environment significantly influences your thoughts, feelings, and behaviors. Intentionally designing your spaces to support your desired future state can have a powerful effect on your ability to achieve your goals and live "future ready".

 

Sponsors: 

 

Wild Health 

Visit WildHealth.com/UNBEATABLE and enter the promo code UNBEATABLE for an exclusive 20% discount on membership.  Embrace this opportunity to prioritize your health. Start your journey to wellness today. 

 

Magic Spoon

Dive into a delicious bowl of Magic Spoon's new high-protein Treats, now available at your nearest grocery store.

 

Momentus:

Designed by the world's best experts, used by the world's best teams and athletes, and made for all of us.

 

https://www.livemomentous.com, and use code DIVINE for 20% off your first order.

 

SealFit ElectroGreens:

Fuel your body and conquer your limits with SealFit ElectroGreens - a USDA organic superfood packed with over 25 organic fruits, vegetables, and electrolytes. Head to Amazon, search for "SealFit ElectroGreens," and use code SEALGREENS25 at checkout for 25% off your order. 

 

Links For Dr. Frederik Pferdt

 

Website 

LinkedIn

Instagram

 

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

militaryhealthpoliticskokoroyogabusinessunbeatablemindleadershipsealfitnavysealsfitnessyogaentrepreneur