PLAY PODCASTS
Kettlebell Kickboxing Canada w/ Jodi Barrett | Fat Fueled Family Podcast Episode 155
Episode 155

Kettlebell Kickboxing Canada w/ Jodi Barrett | Fat Fueled Family Podcast Episode 155

Jodi Barrett had just come through being separated from her partner of 15 years and being a stay-at-home mom when she realized she needed a change. She had three young children, and she needed to be strong, but she also needed to find her passion. After giving the last 13 years to her children & nothing to herself, she to find her place in this world. She needed to create something that was all her own because she had crashed. A friend introduced her to kettlebells. She loved the feeling of the kettlebell in her hands. The weight. The balance. Her entire body engaged and present. Then another interesting opportunity crossed her path: she started working out at a local Muay Thai kickboxing gym. She loved the martial arts aspect. Jodi believes that if we keep our eyes and our heart open we remain open to things that intersect. And this was one of those moments. Despite being a prairie girl – born and raised in Saskatchewan bugging her Dad on the tractor whenever she could, she took a trip to New York to meet with someone about bringing Kettlebell Kickboxing to Canada, and it was the best decision she’s ever made. Today, she’s certified to train Kettlebell Kickboxing trainers across Canada…and she’s the sole franchisee for all of Canada for Kettlebell Kickboxing. The best part of this? One day, one of her girls said to her, “Mom, I have something to tell you…” Oh no, she thought. What is it? “Mom, I want to thank you. I really like myself. And you taught me how to like myself.” Jodi’s one piece of advice is this: If you are lost stop searching and just BE. Listen to the whisper within you that tells you what feels right. Grow your inner strength as it will carry you forward and make you strong on the outside and Dream Big!

The Fat Fueled Family Podcast · Jodi Barrett, Maura Vega, Danny Vega

July 9, 202143m 53s

Audio is streamed directly from the publisher (cdn.simplecast.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Jodi Barrett had just come through being separated from her partner of 15 years and being a stay-at-home mom when she realized she needed a change. She had three young children, and she needed to be strong, but she also needed to find her passion. After giving the last 13 years to her children & nothing to herself, she to find her place in this world. She needed to create something that was all her own because she had crashed.

A friend introduced her to kettlebells. She loved the feeling of the kettlebell in her hands. The weight. The balance. Her entire body engaged and present. Then another interesting opportunity crossed her path: she started working out at a local Muay Thai kickboxing gym. She loved the martial arts aspect. Jodi believes that if we keep our eyes and our heart open we remain open to things that intersect. And this was one of those moments.

Despite being a prairie girl – born and raised in Saskatchewan bugging her Dad on the tractor whenever she could, she took a trip to New York to meet with someone about bringing Kettlebell Kickboxing to Canada, and it was the best decision she’s ever made. Today, she’s certified to train Kettlebell Kickboxing trainers across Canada…and she’s the sole franchisee for all of Canada for Kettlebell Kickboxing.

The best part of this? One day, one of her girls said to her, “Mom, I have something to tell you…”

Oh no, she thought. What is it?

“Mom, I want to thank you. I really like myself. And you taught me how to like myself.”

Jodi’s one piece of advice is this: If you are lost stop searching and just BE. Listen to the whisper within you that tells you what feels right. Grow your inner strength as it will carry you forward and make you strong on the outside and Dream Big!

http://www.kbkbstudio.tv

Instagram: @kettlebellkickboxingcanada

 

Low Carb Hustle podcast: www.lowcarbhustlepodcast.com

 

Announcement Links:

Protein pancakes: https://www.instagram.com/p/CKnRtPrgCGD/

Protein: https://www.seacretdirect.com/300943591/en/us/item/3898/SHAKE-VANILLA-Shake-Vanilla/

Recovery: https://www.seacretdirect.com/300943591/en/us/item/2020/Recovery-Buy-3-Get-1-FREE-Recovery-Promo-Pack-Qty-4/

Molecular hydrogen studies: www.molecularhydrogenstudies.com


 


 

Intro Song - https://soundcloud.com/freemusicforvlogs/kazura-back-to-you-free-music-for-vlogs


 

This week’s sponsor is keto brick, our favorite shelf-stable fat bomb. Keto bricks have great ingredients and there are both vegan and whey options. Use VEGA at checkout for a chance to win a month’s supply of bricks!

Http://www.ketobrick.com


 

**Follow us!**

http://www.instagram.com/fatfueledmom

http://www.instagram.com/dannyvega.ms

http://www.instagram.com/fatfueledkids

YouTube

http://www.youtube.com/fatfueledfamily

Please make sure to SUBSCRIBE and leave us a 5-STAR RATING & REVIEW if you like our content!

Please visit our blog:

http://www.fatfueled.family


 

Carnivore Keto Cut:

https://carnivoreketocut.com/sales-page


 

**PRODUCT CODES and LINKS**

Amazon Store - http://www.amazon.com/shop/fatfueledmom

KetoLogic 10% discount code: FATFUELEDFAM

KetoLogic KETO 30: http://bit.ly/2EaqQRG

KetoLogic BHB gummies: http://bit.ly/2DhgvkH

FBOMB 20% discount code: FATFUELEDFAM

FBOMB nut butters: http://bit.ly/2PySREs

1Up Nutrition Supplements: Use code FFM20 for 20% off your order at https://1upnutrition.com

Carnivore Crisps! - http://www.carnivorecrisps.com Code: FFF to save.

Spiral Band Fitness: Use code MAURA to save 10% at https://www.spiralbandfitness.com

Pili Nuts: FATFUELEDMOM saves you  10% at http://www.eatpilinuts.com

Neuroroast Coffee: KETOCC saves you 10% at http://www.neuroast.com

Select CBD: https://bit.ly/2Aesxgy

Beautycounter Safe Non-Toxic Beauty Products: http://www.beautycounter.com/mauravega

Santa Cruz Medicinals: Save $5 with code fatfueledmom

Fat Fueled Family bundle from eBar Cattle Company:

https://ebarcattlecompany.com/collections/packages/products/fat-fueled-family-bundle

Make sure to use FATFUELEDFAM to save 10% on your entire order!

Topics

carnivoreketogeniccanadafatoptimizationketohigh fatlow carbweight lossdietwellnessmindsetlifestylekettlebells