PLAY PODCASTS
199. 199 ideas that I hadn't made into podcasts yet

199. 199 ideas that I hadn't made into podcasts yet

The Allusionist · Helen Zaltzman

August 30, 202437m 48s

Audio is streamed directly from the publisher (mgln.ai) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Next episode is the 200th, therefore this is the 199th. I raid the 66 pages of ideas for episodes I have been keeping for nearly a decade, and present to you 199 that I have not yet made into podcasts (except for this one).

Find the episode's transcript, plus more information about the topics therein, at theallusionist.org/199ideas.

If you fancy concocting a quiz question for the imminent 200th episode, go to theallusionist.org/quiz to submit it; your deadline is 6 September 2024.

To help fund this independent podcast, take yourself to theallusionist.org/donate and become a member of the Allusioverse. You get regular livestreams with me and my collection of reference books, inside scoops into the making of this show, watchalong parties eg the new season of Taskmaster featuring my brother Andy, and the company of your fellow Allusionauts in our delightful Discord community. 

This episode was produced by me, Helen Zaltzman, with music and editorial assistance from Martin Austwick of palebirdmusic.com. Find @allusionistshow on Instagram, Facebook, Threads, Bluesky, TikTok, YouTube etc.

Our ad partner is Multitude. If you want me to talk about your product or thing on the show, sponsor an episode: contact Multitude at multitude.productions/ads. This episode is sponsored by:

Home Chef, meal kits that fit your needs. For a limited time, Home Chef is offering Allusionist listeners eighteen free meals, plus free shipping on your first box, and free dessert for life, at HomeChef.com/allusionist.
Squarespace, your one-stop shop for building and running your online empire/new home for your cryptic puzzle that takes months to solve. Go to squarespace.com/allusionist for a free 2-week trial, and get 10 percent off your first purchase of a website or domain with the code allusionist.
• Bombas, whose mission is to make the comfiest clothing essentials, and match every item sold with an equal item donated. Go to bombas.com/allusionist to get 20% off your first purchase.  
• LinkedIn Ads convert your B2B audience into high quality leads. Get $100 credit on your next campaign at linkedin.com/allusionist.

Support the show: http://patreon.com/allusionist

See omnystudio.com/listener for privacy information.

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

spidersacnetranslationcobwebtyrepomegranateyolgnudistancevolcanoeshabithatsdeathgranolatoadyoverwhelmbicepsretinabrochureaustraliatwistheadpecuniarymiranda rightsrainfurlongpandanusfrancenamesstillicidegender inclusive languagewordspizzagimbalgobbledegooklawaftermathstereotyperosemary-opolihumourapartheidvampiresacmepositive-tronportmanteauemojiqueerjadecowsposthumousvanity platescomedians-coreduttoscavengerpetitionvampancient romansfinemasterpieceacumennursegrape nutsupper caseembersbearscomedymiasmaludoetymologymedicinebespokemigraineloomclothinghawaiiconcretescrupleknotspatioidiomsjoe lycettdesperatechordproblematicvolcanofoodtrousersfly agariccraftfathomnoonsabotagequeernessveronaparcheesihamelia jenks bloomercourtroomchestfeedingwerewolfvirusesbumswinterfyllethxsamuel maverickaspirinsmellshawaiiansarahnutsphotographydogsattercopsaltydenmarkcapsizeescapestiricidekaleikoa kaʻeoproduct namesshoesmenupopsiclespregnancymushroomsfortepubsrenamingaverageculottesprefixesdessertharlotcrestfallenmalariacopagandafencingtrademarkskarentimecensorshipbrandingbracatusglucoselgbtqia+schwapageantthornbackcattlecaputvindicationmc-technologyjohann fustbloomersplace namesdeletehalcyondmvpunctuationtaintswedenmastersloganfaux pashelen zaltzmanlanguageoathsmaster bedroomnorwayclichesingleoprah winfreyweregildheroinanimalsdoulasperatelimousinepedigreeamateurpluckprintingchaperonespinsterspolicemeasurementcharcuterieripostepucecross stitchtutufoiblecowboysgrenadetreadmillvocabularyfrenchmele kalikimakajuliet clublost positivesrichard kimbleproblematic eponymsjohannes gutenbergkensington goreromeo and julietextravagantelixiralbumgermanetravestyikeaclotheslegalcandletwistlower casekevinhoodsberetcalendarproductsboudoirpastrysign languagesaintswhelmcroupiersmileseuphemismseponymskdwellscoutscapeskaputcynosurevalidmaury mavericklost letterstabloidmagentapopsicleprotestgender inclusivityhistorysuffixesbad decisionsrivalmavericknegative