PLAY PODCASTS
Taking a Hit with Dr. Staci Gruber and Ricky Williams
Season 13 · Episode 25

Taking a Hit with Dr. Staci Gruber and Ricky Williams

How are attitudes toward cannabis changing? Neil deGrasse Tyson, Chuck Nice, and Gary O’Reilly discuss marijuana’s effects on mental health with former football pro turned cannabis professional, Ricky Williams, and Harvard neuroscientist, Dr. Staci Gruber.

StarTalk Radio · Chuck Nice, Neil deGrasse Tyson, Staci Gruber, Gary O'Reilly, Ricky Williams

July 22, 202252m 52s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

How are attitudes toward cannabis changing? Neil deGrasse Tyson, Chuck Nice, and Gary O’Reilly discuss marijuana’s effects on mental health with former football pro turned cannabis professional, Ricky Williams, and Harvard neuroscientist, Dr. Staci Gruber.

NOTE: StarTalk+ Patrons can watch or listen to this entire episode commercial-free here: https://startalkmedia.com/show/taking-a-hit-with-dr-staci-gruber-and-ricky-williams/

Photo Credit: United States Fish and Wildlife Service, Public domain, via Wikimedia Commons

Subscribe to SiriusXM Podcasts+ to listen to new episodes of StarTalk Radio ad-free and a whole week early.
Start a free trial now on Apple Podcasts or by visiting siriusxm.com/podcastsplus.


Hosted by Simplecast, an AdsWizz company. See pcm.adswizz.com for information about our collection and use of personal data for advertising.

Topics

painbotanicalsstar talkterpenesheismanweedmedicinericky williamsbrittney griner2aglester grinspoonamotivational syndromeopiodsnflstartalkwadafootballneurotransmitterscannabisscience podcasterrick mironanandamidesha’carri richardsoncbdmarijuanastaci gruberalcoholthcephemerismaxwell’s demonchuck nicegary o’reillymental healthreceptorscouch lockcarl saganpotendocannabinoid systemneil degrasse tysonhighsman