PLAY PODCASTS
How Storytelling Transforms Your Video Content
Episode 765

How Storytelling Transforms Your Video Content

Maximum Lawyer

May 31, 202510m 49s

Audio is streamed directly from the publisher (media.transistor.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Watch the YouTube version of this episode HERE


Are you looking for a unique way to change how to market to clients? In this episode of the Maximum Lawyer podcast, host Tyson Mutrux delves into the art of storytelling for law practices, inspired by Peter Guber, a renowned author and film producer. 


Tyson shares how to effectively tell a story as a lawyer. It is important to begin with a challenge, obstacle or question. This will capture the emotional attention of the audience and keep them interested. Then the struggle is introduced to get the audience to identify and relate to a person. From there, the resolution is shared, where the climax occurs leading to an emotional release from the audience. The transformation involves the lesson learned from the situation. Lastly, there is a call to action, where there is an invitation for the audience to reflect and act. All of these steps can be used when telling a story to a potential client through marketing and social media efforts.


Take a listen to learn more.

02:10 The Sequence of a Great Story

03:02 Starting with a Challenge 

04:03 Introducing the Struggle 

05:05 Resolution: The Turning Point

06:12 Transformation of the Character 

Tune in to today’s episode and checkout the full show notes here.

Topics

brandingemployeesentrepreneurfirmlawlawfirmmarketinglawyermarketingsolopreneur