PLAY PODCASTS
Growing Pains and Solutions for a Brand New Solo w/ Ryan Brown
Episode 142

Growing Pains and Solutions for a Brand New Solo w/ Ryan Brown

Maximum Lawyer

April 24, 201938m 22s

Audio is streamed directly from the publisher (media.transistor.fm) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

Visit MaximumLawyer.com for complete show notes of each podcast episode, tips, hacks and more resources! 

 

Today on the show we have Ryan Brown, a long-time member but brand new criminal defense attorney with his own solo practice in rural Georgia. In this episode we’ll discuss some of the biggest issues he runs into as a new attorney, as well as give him suggestions on how to expand his firm so that he can focus on the areas of practicing he loves, all without compromising his vision.

 

We’ll talk about:

-Recognizing systems you can improve and actually following through

-How to integrate automation into your solo or small size law firm

-When you should hire your first employee

-What to do with good domain names that you own but aren’t using

-Targeting and attracting younger clients

-The types of content that are best when you are starting out

 

Hacking’s Hack: There’s this little conference coming up called “MaxLawCon19” that is pretty close to selling out. Make sure you don’t miss it.

This week two different members of the group set up “Maximum Lawyer” lunches in their respective cities. We encourage this and will be doing this soon in St.Louis.

 

Tyson’s Tip: Jim stole my tip, but I want to add that we will be announcing a lunch date some time in the next week.

I have been subscribed to Adobe Cloud for awhile, but didn’t realize how much I had access to. I highly recommend it, especially for video.

 

Ryan’s Tip: Grammarly is great for guys like me who are fast typers, especially if you are doing a lot of typing online.

Ryan's Website: https://www.jryanbrownlaw.com/ryan-brown

 

Make sure to register for MaxLawCon19, June 6 and 7 in St.Louis.

 

For more content from us please subscribe to our Youtube Channel

 

Thanks so much for listening to the show! If you want to know more about this and keep on maximizing your firm, please join our Facebook Group or like us on Facebook and comment!

 

You can also go to MaximumLawyer.com or, if you’d prefer, email us at: [email protected]

 

Interested in being on the show? Shoot us an email at [email protected] or message us on Facebook!

 

Welcome to the Maximum Lawyer Podcast. Partner up, and maximize your firm.


Resources:

Topics

brandingemployeesentrepreneurfirmlawlawfirmmarketinglawyermarketingsolopreneur