PLAY PODCASTS
ANGELS POSTCAST: Halos complete SHOCKING Freeway-Series SWEEP of Ohtani's Dodgers with 6-4 win in LA
Episode 1605

ANGELS POSTCAST: Halos complete SHOCKING Freeway-Series SWEEP of Ohtani's Dodgers with 6-4 win in LA

GET OUT THE BROOMS! For the third straight game, the Los Angeles Angels used runs in the first and ninth innings to help earn a 6-4 win on Sunday and clinch a stunning Freeway-Series SWEEP of the Los Angeles Dodgers. In this Locked On Angels Postcast, Gavin Carlson breaks down the HR swings from Zach Neto, Taylor Ward, and Travis d'Arnaud, praises Yusei Kikuchi's impressive start, and trolls Dodger Nation with a broom all show long!

Locked On Angels - Daily Podcast On The Los Angeles Angels · Gavin Carlson

May 19, 202525m 36s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

GET OUT THE BROOMS! For the third straight game, the Los Angeles Angels used runs in the first and ninth innings to help earn a 6-4 win on Sunday and clinch a stunning Freeway-Series SWEEP of the Los Angeles Dodgers. In this Locked On Angels Postcast, Gavin Carlson breaks down the HR swings from Zach Neto, Taylor Ward, and Travis d'Arnaud, praises Yusei Kikuchi's impressive start, and trolls Dodger Nation with a broom all show long!

Follow Gavin Carlson on X/Twitter @GavinCarlson_ and share your thoughts on the game with him on X/Twitter and in the YouTube comments section! Leave a LIKE before you go!

 

Support Us By Supporting Our Sponsors!

 

Wonderful Pistachios

Looking for a snack that’s both delicious and nutritious? Get snackin’ and get crackin’ with the snack that packs a protein punch. Visit WonderfulPistachios.com to learn more.

 

Just Ingredients

Visit JustIngredients.us and use code LOCKEDONMLB for 20% off your order! And for more wellness tips, follow @just.ingredients on Instagram.

 

Supply House

Join the TradeMaster program today at SupplyHouse.com/TM and start ordering plumbing, HVAC, and electrical supplies with just a few clicks. Plus, use promo code S-H-5 for 5% off your first order. That’s SupplyHouse.com!

 

Monarch Money

Take control of your finances with Monarch

Money. Use code LOCKEDONMLB at monarchmoney.com for 50% off your first year.

 

Gametime

Download the Gametime app, create an account, and use code LOCKEDONMLB for $20 off your first purchase. Terms apply. Download Gametime today. What time is it? Gametime.

 

FanDuel

Right now, new customers can get TWO HUNDRED DOLLARS in BONUS BETS when your first FIVE DOLLAR BET WINS! Download the app or head to FANDUEL.COM to get started. Bet with FanDuel—Official Partner of the NBA.

 

FANDUEL DISCLAIMER: 21+ in select states. First online real money wager only. Bonus issued as nonwithdrawable free bets that expires in 14 days. Restrictions apply. See terms at sportsbook.fanduel.com. Gambling Problem? Call 1-800-GAMBLER or visit FanDuel.com/RG (CO, IA, MD, MI, NJ, PA, IL, VA, WV), 1-800-NEXT-STEP or text NEXTSTEP to 53342 (AZ), 1-888-789-7777 or visit ccpg.org/chat (CT), 1-800-9-WITH-IT (IN), 1-800-522-4700 (WY, KS) or visit ksgamblinghelp.com (KS), 1-877-770-STOP (LA), 1-877-8-HOPENY or text HOPENY (467369) (NY), TN REDLINE 1-800-889-9789 (TN)


Hosted by Simplecast, an AdsWizz company. See pcm.adswizz.com for information about our collection and use of personal data for advertising.

Topics

zach netolocked ongonsolinmookie bettsmike trouthalosyuseitaylor wardtyler andersonhrmoncadamlblawinjo adelljanseninjurylos angeles angelshome runseriesjose sorianoal westfreddie freemanreid detmersmorenododgersnolan schanuelwalk-offlogan o’hoppeanaheimnerissellstrikeouthitkimlos angelesjorge solerarteron washingtonsweepohtanikenleykikuchifreewayangelsrivalryparisfirehalo broskyle hendricksshoeheiillaa