PLAY PODCASTS
Ep. 406 J J Virgin has arms for days and is telling you what you need to age WELL...
Episode 406

Ep. 406 J J Virgin has arms for days and is telling you what you need to age WELL...

Just Jenny · Jenny Hutt

February 12, 202544m 26s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

My dear friend JJ Virgin is on the podcast for this weight wednesday drop. As always, JJ has wisdom coupled with expertise validated by science and life experience! JJ talks protein, vegetables, exercise, having a good attitude and more. I learn something every time we speak!

JJ Virgin: Certified Nutrition Specialist Board Certified In Holistic Nutrition® Certified Personal Trainer

As a triple-board certified nutrition expert and Fitness Hall of Famer, JJ is a passionate advocate of the healing power of nutrition, and is mission driven to change the way the world sees aging and longevity.

She has launched 2 multimillion-dollar businesses, including a 7-figure personal brand, and founded the Mindshare Collaborative, the most influential professional community in health, having propelled more New York Times bestsellers, PBS specials, and 7 figure brands than any other community.

JJ is a prominent TV and media personality who co-hosted TLC’s Freaky Eaters and was the nutrition expert for Dr. Phil’s Weight Loss Challenges. She’s made numerous appearances on PBS, Dr. Oz, Rachael Ray, Access Hollywood, and The TODAY Show. She also speaks regularly, commanding audiences of 10,000 or more, and has shared the stage with other highly sought-after experts including Tony Robbins, Seth Godin, Lisa Nichols, Gary Vaynerchuk, Dr. Mark Hyman, Dan Buettner, Mary Morrissey and more. She regularly teaches for Tony Robbins’ Life Mastery Program.

JJ is the author of four NY Times bestsellers: The Virgin Diet, The Virgin Diet Cookbook, JJ Virgin’s Sugar Impact Diet, and JJ Virgin’s Sugar Impact Diet Cookbook. Her book, Warrior Mom: 7 Secrets to Bold, Brave Resilience, shares the inspirational lessons JJ learned as she fought for her son’s life.

Evidence of JJ’s far-reaching impact can be seen in the millions of views on her YouTube channel, Instagram and Facebook, and through her popular podcast Well Beyond 40 with JJ Virgin, which has more than 21 million downloads and counting.

JJ is a 3x Inc. 5000 Founder and a top 10 finalist for the John C Maxwell award. As an authority on transformational leadership, she has coached some of the biggest names in health and transformed the lives of millions of people around the world.


Email all questions, comments and legal requests to me anytime at [email protected]

And of course please follow me on instagram and threads @justjennyhutt and tiktok/twitter @jennyhutt.  Thank you for your sharing episodes you love with your community. Every download is appreciated! To join my Patreon and support my doing this podcast and to be part of the patreon subscriber zooms please subscribe Patreon.com/jennyhutt it is only $5/month. You also get the video of each episode!

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

kidsrelationshipshealthweightfamilylifestyle