PLAY PODCASTS
Ep. 392 Mind Pump's Sal DiStefano has a lot to say...
Episode 392

Ep. 392 Mind Pump's Sal DiStefano has a lot to say...

Just Jenny · Jenny Hutt

December 18, 202456m 28s

Audio is streamed directly from the publisher (dts.podtrac.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

I love when @mindpumpdistefano stops by the podcast. Sal is so knowledgeable and real. He is definitely a favorite weight wednesday guest.

Sal Di Stefano’s passion for fitness began when he picked up his first barbell at 13 years old. Any other teenager would have done a set of curls, but legend has it, Sal did squats. He was always different like that – and it wasn’t long until everyone would notice.

At age 18, Sal started working as a personal trainer, becoming the youngest general manager at 24 Hour Fitness by 19. Not long after, he opened his own studio. Its reputation and success proved he was more than a personal trainer, but also a gifted businessman. And it was this entrepreneurial spirit that guided Sal to where we see him today.

He is the voice of Mind Pump, a published author, and one of the most trusted and respected faces in the fitness industry. Sal is an indispensable podcast host: the one who summarizes research when Justin and Adam trip over scientific words, the proverbial guinea pig when there’s a new peptide, and the conductor trying his best to keep conversation on track when we all know it’s headed off the rails. Follow Sal on social media @mindpumpdistefano and @mindpumpmedia

Email all questions, comments and consulting requests to me anytime at [email protected]

And of course please follow me on instagram and threads @justjennyhutt and tiktok/twitter @jennyhutt.  Thank you for your sharing episodes you love with your community. Every download is appreciated! To join my Patreon and support my doing this podcast please subscribe Patreon.com/jennyhutt it is only $5/month and you get the video of each episode!

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

kidsrelationshipshealthweightfamilylifestyle