PLAY PODCASTS
The Imposter Princess that Sealed Their Doom

The Imposter Princess that Sealed Their Doom

a bit late · a bit late

June 13, 202534m 47s

Audio is streamed directly from the publisher (rss.art19.com) as published in their RSS feed. Play Podcasts does not host this file. Rights-holders can request removal through the copyright & takedown page.

Show Notes

What happens when you try to outrun prophecy? Can it be done? In this tale, a royal family tries to do just that, but do they end up fulfilling it while trying to avoid it? Join me for this wild story about a deadly fairy prediction, and find out! Along the way we’ll meet 2 handsome princes, a beautiful princess, a lot of cockchafers and peacocks, and even a feisty little dog that makes all the difference in their fates! Friends and fiends, get comfy and cozy, summon your familiars, light your fairy lights and grab a mug of your favorite tea and follow me!

Get Nebula for 40% off with my link ► https://go.nebula.tv/abitlate

Watch my latest on Nebula First! ► https://nebula.tv/videos/abitlate-a-bit-of-pride-and-prejudice-asmr-storytelling?ref=abitlate

Check out Worldsmiths ► https://nebula.tv/worldsmiths?ref=abitlate


This episode was originally released on May 6th, 2025 on YouTube, and ad-free on Nebula First on April 19th, 2025

"Decline, Ancient Winds" by Kevin MacLeod (incompetech.com) Licensed under Creative Commons: By Attribution 4.0 License creativecommons.org/licenses/by/4.0/ 

This tale is from a compendium of tales by Andrew Lang, which is now in public domain. I have added my voice, thoughts, animated illustrations and Creative Commons music (above).

Public Domain featured illustrations by Gustaf Tenggren and John Gilbert.

See Privacy Policy at https://art19.com/privacy and California Privacy Notice at https://art19.com/privacy#do-not-sell-my-info.

Topics

audiobooklorestorytellingabitfrankbrothers grimmgrimmforgotten storyold fairytalesleep storynarratorreadingbedtime storybookishcalmabitlateasmra bit latedark fairydark fairytaledark fairy taleDisney PrincessDisneyprincess rosetteanexietyunabridgedgrimms fairytalesbookishgrimmcreepypastafairytalesfolkloremythologyBooknarrationsleepfairytalefantasy